SKU: 12437427463

Human Dystrophin, His Tag

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 21 - Aug 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Dystrophin, His TagProduct Specification Species Human Accession P11532 Amino Acid Sequence Protein sequence(P11532, Gly3046 Thr3306 with C 10*His) MGPASQHFLSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight

Product Specification


Species Human
Accession P11532
Amino Acid Sequence

Protein sequence(P11532, Gly3046-Thr3306 with C-10*His)


MGPASQHFLSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical: 31.6kDa Actual: 27kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Dystrophin is a protein located between the sarcolemma and the outermost layer of myofilaments in the muscle fiber (myofiber). It is a cohesive protein, linking actin filaments to other support proteins that reside on the inside surface of each muscle fiber's plasma membrane (sarcolemma).Dystrophin supports muscle fiber strength, and the absence of dystrophin reduces muscle stiffness, increases sarcolemmal deformability, and compromises the mechanical stability of costameres and their connections to nearby myofibrils. Dystrophin deficiency has been definitively established as one of the root causes of the general class of myopathies collectively referred to as muscular dystrophy. The deletions of one or several exons of the dystrophin DMD gene cause Duchenne and Becker muscular dystrophies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 12437427463

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Randy H.
Massapequa, US
★★★★★ 5
Good hitch cover
Color: Black, Size: 1
This is a well made,tight fitting hitch cover but the holding strap is too small to go over the hitch lip so I used my wife’s hair dryer to heat it up a skosh and voila! Fit like a charm! I recommend this cover.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 22, 2026
S
Verified Purchase
Shawn
West Palm Beach, US
★★★★★ 5
Should have been like this from the factory!
Size: For 3rd Gen Tacoma (2016-2023), Color: Black
bgucar Driver Side A-Pillar Grab Handle for Toyota Tacoma is a practical interior upgrade designed to provide added support, convenience, and style for Tacoma owners. Built specifically for Toyota Tacoma models, this grab handle offers a secure grip for entering and exiting the vehicle while also enhancing the rugged appearance of the interior. One of the first things I noticed about the bgucar Driver Side A-Pillar Grab Handle is how sturdy and comfortable it feels once installed. The handle provides excellent support when getting into the truck, especially for lifted Tacomas or vehicles with larger tires that sit higher off the ground. The construction feels durable and well-made, with solid materials that match the rugged nature of the Tacoma. The handle has a secure grip texture that feels comfortable in the hand while maintaining stability during daily use and off-road driving. Installation is another major advantage. The grab handle is designed for a straightforward fit on compatible Toyota Tacoma models, and the included hardware makes the process relatively simple. Most users can complete the installation with basic tools in a short amount of time. Another standout feature is the improved accessibility it provides. Whether climbing into the truck, navigating uneven terrain, or assisting passengers, the handle adds extra confidence and convenience during entry and exit. The design also blends nicely with the Tacoma’s interior styling. It looks like a factory-style upgrade rather than an aftermarket accessory, helping maintain a clean and cohesive appearance inside the cabin. I also appreciate the added functionality during off-road trips and rough driving conditions. The grab handle offers additional stability for the driver when traveling over bumps, trails, or uneven surfaces, making the driving experience feel more secure. The finish and overall appearance are attractive and complement the rugged personality of the Tacoma. It adds a subtle but useful enhancement without looking bulky or out of place. Another benefit is the durability during long-term use. The handle remains firmly mounted without rattling or loosening, even after repeated use and exposure to varying driving conditions. The packaging is organized and includes the necessary mounting components, making installation easier and more convenient. Instructions are generally clear, helping simplify the setup process for first-time installers. For Tacoma owners looking for a functional and stylish interior accessory, the bgucar Driver Side A-Pillar Grab Handle is an excellent option. Its sturdy construction, easy installation, and practical support make it a valuable addition for both daily driving and off-road adventures. After regular use, I’ve been very satisfied with its overall quality and performance. The added support makes entering and exiting the truck easier, while the durable design provides confidence during every drive. Overall, the bgucar Driver Side A-Pillar Grab Handle for Toyota Tacoma is a highly recommended upgrade for drivers seeking improved convenience, support, and interior functionality. Its durable build, secure grip, and factory-style appearance make it a smart addition for enhancing both comfort and usability.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
P
Verified Purchase
Petros.Philosophia
Lexington, US
★★★★★ 5
High quality grab handle for 3rd Gen Tacoma
Size: For 3rd Gen Tacoma (2016-2023), Color: Gray, Size: For 3rd Gen Tacoma (2016-2023), Color: Gray
Wanted one of these driver side grab handles for while but could only find it in black. When I saw it available in my trim color immediately ordered it. Installation was a breeze, the fit and color match is absolute perfection with a solid, firm mount. Looks and functions like OEM. This is a high quality, well designed grab handle.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 21, 2026
J
Verified Purchase
Jonathan
Bozeman, US
★★★★★ 5
Best Tacoma interior mod hands down!
Size: For 3rd Gen Tacoma (2016-2023), Color: Black, Size: For 3rd Gen Tacoma (2016-2023), Color: Black
One of the best mods you can do for your Tacoma. I love my truck but the biggest gripe for the interior was no grab handle on the driver side. This solves that with a very OEM look. Only took about 5 minutes to install and comes with all the hardware and even tools to do so. It is very sturdy as well. If you’re on the fence about buying it just purchase it! Well worth the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 31, 2026
B
Verified Purchase
blackdress1800
Lexington, US
★★★★★ 5
Looks Factory, Installs in Minutes
Size: For 3rd Gen Tacoma (2016-2023), Color: Black
This driver-side A-pillar grab handle was exactly what my Tacoma should’ve had from the factory. Installation was genuinely easy. The instructions were clear and straightforward, and while a tool is included, I found a long 10mm socket made the job even faster and easier—especially for getting clean torque without fighting angles. Fitment was spot on with no gaps, rattles, or creaking once installed. The texture and finish match the passenger side perfectly, so it doesn’t scream “aftermarket” at all. It looks OEM because, functionally and visually, it might as well be. Solid feel, sturdy construction, and a big improvement for getting in and out of the truck. Five stars without hesitation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 7, 2026

recommand products