SKU: 20770810889

FGF-21 Protein, Human

Sale price$122.40 Regular price$136.00
Save 10%

Pay in installments of $34.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FGF-21 Protein, HumanProduct Specification Species Human Synonyms Fibroblast growth factor 21 Accession Q9NSA1 Amino Acid Sequence His29 Ser209, with N terminal 6*His MHHHHHHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS Expression System E. coli Molecular Weight 25 kDa(Reducing) Purity 97% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation

Product Specification


Species Human
Synonyms Fibroblast growth factor 21
Accession Q9NSA1
Amino Acid Sequence

His29-Ser209, with N-terminal 6*His MHHHHHHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Expression System E.coli
Molecular Weight

25 kDa(Reducing)

Purity

>97% by SDS-PAGE & RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

20mM Tris, 100mM NaCl, pH7.5

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Background

Fibroblast growth factor 21 (FGF-21) is a pleiotropic hormone considered as a major regulator of energy homeostasis. FGF-21 is mainly secreted by the liver, but it may also be expressed in skeletal muscle. In this sense, FGF-21 protein expression is induced by insulin in C2C12 myocytes, and FGF21 mRNA is upregulated by hyperinsulinemia in skeletal muscle in young healthy men. Moreover, it has been suggested that FGF-21 is a signal secreted by the skeletal muscle to communicate with adipose tissue under stress conditions. FGF21 has been shown to be a major regulator of hepatic lipid metabolism, with FGF-21 overexpressing mice being resistant to diet-induced obesity. Interestingly, recent studies suggest that FGF21 may exert anti-inflammatory actions in the pancreas, heart, and skeletal muscle. A reduction in the JNK and NF-κB signaling pathways has been proposed as the potential mechanism implicated in the FGF-21 anti-inflammatory effects.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 20770810889

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Aliyha M.
West Palm Beach, US
★★★★★ 5
Love them!
Size: 3-Panel
It was funny to get together. Fun moments. My grandfather whom forgot to look down, stepped on it, slid, and did the splits.. there was a little smudge haha. But— its been a year and I still love them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
H
Verified Purchase
House_D
Fort Morgan, US
★★★★★ 5
Great home office dividers!
Size: 3-Panel
Needed something to create a home office that would stand on an uneven basement floor. These are the perfect solution! No prying eyes and only took me an hour to put up both sets by myself, pretty easy. They are completely opaque.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 26, 2025
E
Verified Purchase
Excelente colchón es una ricura dormir lo recomiendo
Phoenix, US
★★★★★ 5
Es fácil de armarlo y de utilizarlo adaptarlo a tu entorno
Size: 3-Panel, Size: 3-Panel
Es lo que necesitaba tal y cual como está en la foto
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
J
Verified Purchase
Jason Dusterwald
Charlottesville, US
★★★★★ 4
Fine Simple Product, Works as Advertised
Size: 3-Panel
Performs as advertised, a simple upright divider. I use it to mark my "office" space when working from home. Assembly was straightforward and well documented. One person can do it, but a second person can be helpful when sliding the fabric divider pieces onto their poles. Part quality is fine for the price point. The only mild annoyance is that the upright poles can start getting loose from the metal feet, and need to be retightened occasionally (Allen wrench is included, keep it handy for retightening). It's fairly lightweight and easy to reposition, but the feet are heavy enough to keep it steady once placed. All in all, a good product. I was pleased enough to buy a second one when my son wanted something to block sunlight from behind his computer desk.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 18, 2025
S
Verified Purchase
Sheila Cash
New York, US
★★★★★ 1
Wobbly and Poor Design
Size: 1-Panel
Update: nope! Not worth the money. My cat simply brushed against the divider, and it fell, knocking breakable things over. Not safe! It serves it's purpose, but...the screws were basically glued to the packaging. It took me longer to get the screws out of the packaging than it did to put it together. The assembly was easy. I am not mechanically inclined by any means, but the instructions, despite being very hard to read (I have over 40 eyes), were pretty simple. Structurally, it is very wobbly. I think they should have designed it with a middle rod to keep it more stable. I find that the attachments to the rods are wobbly and should have been screwed rather than popped into an attachment hole without reinforcement. That would have also made the room divider more stable. I have cats, but the material is easy to clean. I took a damp cloth to it, and it came right off. As far as see-through...I think it does a great job of masking theO other side of the room.. I just wish it was a little longer and closer to the floor stand. I like that it came with extra parts. It's just a very cheaply made item, and I don't think the price for the item reflects how cheaply it is made, how wobbly and unstable it is, or the poor design.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2025

recommand products