SKU: 45012498718

Frizzled-5/FZD5 Fc Chimera Protein, Human

Sale price$184.50 Regular price$205.00
Save 10%

Pay in installments of $51.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 23 - Aug 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Frizzled-5/FZD5 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms C2orf31, Fz 5, hFz5, FzE5 Accession Q13467 Amino Acid Sequence Ala27 Pro167, with C terminal Human IgG Fc

Product Specification


Species Human
Synonyms C2orf31, Fz-5, hFz5, FzE5
Accession Q13467
Amino Acid Sequence

Ala27-Pro167, with C-terminal Human IgG Fc ASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 55-60kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Sun Y. et al. (2020) FZD5 contributes to TNBC proliferation, DNA damage repair and stemness. Cell Death and Disease. 11: 1060.1/2

Background

FZD5, a member in Frizzled family, was identified to be preferentially expressed in TNBC (triple-negative breast cancer), and associated with unfavorable prognosis. Loss and gain of function studies revealed that FZD5 contributed to TNBC cell G1/S transition, DNA replication, DNA damage repair, survival, and stemness. Mechanistically, transcription factor FOXM1, which promoted BRCA1 and BIRC5 transcription, acted as a downstream effecter of FZD5 signaling. FOXM1 overexpression in FZD5-deficient/low TNBC cells induced FZD5-associated phenotype. Finally, Wnt7B, a specific ligand for FZD5, was shown to be involved in cell proliferation, DNA damage repair, and stemness. Taken together, FZD5 is a novel target for the development of therapeutic strategies to overcome chemoresistance and prevent recurrence in TNBC.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 45012498718

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Matthew
Carnegie, US
★★★★★ 5
Smells great, lasts forever
Frankly I think it’s the best body wash in existence. Smells great and a single pump is all you need so it lasts forever
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
L
Verified Purchase
Lisabeth
New York, US
★★★★★ 5
Elevates my shower routine—luxury scent without the luxury price
I’ve been using the Cremo Palo Santo body wash for a few weeks now, and I’m genuinely impressed. The scent is rich and complex—bright cardamom, dry papyrus, and aromatic palo santo blend together to create a fragrance that’s both grounding and refreshing. It’s like a spa experience in your own shower. The formula lathers up beautifully, turning into a creamy foam that feels moisturizing without being greasy. My skin feels clean and soft afterward, not tight or dry. I appreciate that it’s designed for all skin types, and I haven’t experienced any irritation. What really stands out is the longevity of the scent. It lingers subtly on the skin, and I’ve even noticed it on my clothes the next day. It’s not overpowering, just a pleasant, masculine aroma that makes me feel put-together. For the price, this body wash offers a premium experience. It’s a great way to elevate your daily routine without splurging on high-end brands. I’ll definitely be repurchasing and exploring other scents in Cremo’s Reserve Collection.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 13, 2025
L
Verified Purchase
Lucy
Pawtucket, US
★★★★★ 5
smells luxurious
smells so luxurious. i am on my third bottle and just purchased the fragance as well as the bar soap. thats how much i love the fragance. i wills say, its really intense smell so dont recommend if you are sensitive to strong/lingering smells. leaves my skin super soft. great value for the money, honestly suprised that is not more expensive. its advertised for men but i use it too and love. definetly good for women too who like intense woody/smoky scents.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 19, 2025
W
Verified Purchase
Wanzi
Grantham, US
★★★★★ 4
Great Value
You are getting a lot for the money when you get this body wash. It smells great and is an overall wonderful product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 7, 2026
E
Verified Purchase
Ehul Roscoe Davis
Houston, US
★★★★★ 5
Smells so good
Love this stuff! Very concentrated. A little goes a long way. Smells amazing and leaves your skin soft and smooth.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026

recommand products