SKU: 45357149263

DDB1/CRBN Complex, Flag&His Tag, Human

$162.00 $180.00
Save 10%
No.2 Bestseller on mapetitemediatheque.fr >

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 10 - Jul 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

DDB1/CRBN Complex, Flag&His Tag, HumanProduct Specification Species Human Synonyms DDB1 CRBN Complex Accession Q16531Q96SW2 Amino Acid Sequence DDB1 Flag Tag, Human Met1 His1140

Product Specification


Species Human
Synonyms DDB1/CRBN Complex
Accession Q16531、Q96SW2
Amino Acid Sequence

DDB1 Flag Tag, Human
Met1-His1140
DYKDDDDKMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR
TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
CRBN His Tag, Human
Met1-Leu442
HHHHHHHHGGGSGGGSMAGEGDQQDAAHNMGNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQEREAQFGTTAEIYAYREEQDFGIEIVKVKAIGRQRFKVLELRTQSDGIQQA
KVQILPECVLPSTMSAVQLESLNKCQIFPSKPVSREDQCSYKWWQKYQKRKFHCANLTSWPRWLYSLYDAETLMDRIKKQLREWDENLKDDSLPSNPIDFSYRVAACLPIDDVLRIQLLKIGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTIPDTEDEISPDKVILCL
Expression System Baculovirus-InsectCells
Molecular Weight

128&53kDa (Reducing)
Purity ＞95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tags & Cleavage sites Flag Tag; His Tag
Physical Appearance Liquid
Storage Buffer 20mM Tris,300mM NaCl,10%Glycerol,1mM DTT, pH7.5.
Stability & Storage

·12 months from date of receipt, -20 to -70 °C as supplied.
·1 month, 2 to 8 °C under sterile conditions after reconstitution.
·Please avoid repeated freeze-thaw cycles.
Reference

Fischer E.S.,et al. (2014) Nature 512: 49
He Y.J., et al. (2006) Genes Dev. 20: 2949
Ito T., et al. (2010) Science 327: 1345
Wang H., et al. (2006) Mol. Cell 22: 383

Background

Cereblon (CRBN) is the substrate recognition component of DCX (DDB1-CUL4-X-box) E3 Ubiquitin ligase complexes that mediate the ubiquitination of numerous target proteins including the transcriptional regulator MEIS2. CRBN plays an important role in limb outgrowth, and its function in this process is perturbed by the binding of thalidomide and related compounds. Binding of CRBN to Cullin-4 is mediated in part by DNA damage-binding protein 1 (DDB1), a component of multiple DCX class ligases. In addition to its role in limb development, DDB1 is also involved in various DNA damage response mechanisms. This product consists of an untagged complex of DDB1 and CRBN.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 45357149263

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 2265 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
So pretty
Carnegie, US
★★★★★ 5
Luvs pulls up are the best
Size: 5T-6T, Unit Count: 48
I love this brand. It’s very secure, and the adjustable band makes it easy to tighten without taking off my child’s pants. It doesn’t leave an odor, the texture is smooth, and my child is always comfortable. The price matches the quality, and there’s no leakage or spillover. Overall, it’s very durable. Make sure to have it correctly fastened because the Velcro can leave scratches on child skin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 9, 2025
L
Verified Purchase
L
Louisville, US
★★★★★ 4
Toddler approved
Size: 4T-5T, Unit Count: 99
Fits true to size and easy to pull up and down by my toddler. Very absorbent - perhaps a little too absorbent as it's taking my daughter forever to be potty trained and she's content in her soiled training pants... Great quality overall.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 29, 2025
M
Verified Purchase
Marie33kl
Draper, US
★★★★★ 5
They prevent leaks, and fit great!
We have always used Huggies diapers for our babies and young toddlers because they were the only ones that never leaked or caused a rash. My second daughter was fully potty trained at 2.5 years old and never needed pull-ups. However, our third daughter, who also trained at 2.5 years old, digressed with her nighttime potty training due to instability - we moved twice within the first 6 weeks after she potty trained. So we had to get pull-ups for her to wear at night. Obviously since we loved Huggies diapers, we tried Huggies Pull-Ups, and again, they did not disappoint! They never leak, even on nights when she doesn't get up to go at all, and has lots of pee, and they have never caused a rash either, no matter how full. She's been using them for 1.5 years, at night, and we have never had any issues. They are dependable: decently comfortable to the child, do not cause rashes, fit properly with the ability to adjust at the thigh (if needed), and they prevent leaks! I highly recommend them!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 19, 2025
K
Verified Purchase
Kathy
Carnegie, US
★★★★★ 5
Price good
Size: 5T-6T, Unit Count: 80
Perfect for starters
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
A
Verified Purchase
Alex Thrace
Bozeman, US
★★★★★ 5
Highly effective
I typically take Vitamin D in large amounts to get enhanced benefits for bone strength and immune strength. this formulation includes vitamin K which enhances the absorption of calcium in your system. These are high strength capsules with 5000 units of D in a small and easy to swallow capsule. As with any vitamin product it takes some time for the benefits to be felt however with these products they seem to have better effectiveness than my previous brand and I find myself not having to take as much to get the full benefit. The price is good for a premium product and the developers seem to have put a lot of thought into the formulation. I am fussy about my supplements and always buy the best that I can find. The known benefits of Vitamin D are many and it is essential for your good health. Yes, you can get slightly cheaper D capsules in Costco but that is false economy, as overall it will take more to get the same benefit. I love this company and all their products are top-shelf. Don't shortchange your health. I will buy these again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 19, 2019

recommand products

Island (323) [Commander 2014]
400.00
Austere Command (Invocation) [Amonkhet Invocations]
47000.00
Country Living 6-Piece Stainless Steel Cookie Cutter Set (3 Paw-Shaped, 3 Bone-Shaped)
12.99
Ava's Pet Palace Organic Baked Dog Treats - Cheeze Pleeze (6 oz) / 2-Pack
18.99
Country Living Foldable Fabric Dog Toy Storage Bin - Convenient Organizer for Pet Accessories
19.99