SKU: 49834488302

Human CD16b, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD16b, His tagProduct Specification Species Human Synonyms Low affinity immunoglobulin gamma Fc region receptor III B, Fc gamma RIII beta, FcR 10, IgG Fc receptor III 1, FCGR3B, FCG3, FCGR3, IGFR3 Accession O75015 Amino Acid Sequence Protein sequence(O75015, Gly17 Ser200, with C 10*His)

Product Specification


Species Human
Synonyms Low affinity immunoglobulin gamma Fc region receptor III-B, Fc-gamma RIII-beta, FcR-10, IgG Fc receptor III-1, FCGR3B, FCG3, FCGR3, IGFR3
Accession O75015
Amino Acid Sequence Protein sequence(O75015, Gly17-Ser200, with C-10*His) GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:22.5kDa Actual:35-50kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD16, also known as FcγRIII, is a cluster of differentiation molecule found on the surface of natural killer cells, neutrophils, monocytes, macrophages, and certain T cells. CD16 has been identified as Fc receptors FcγRIIIa (CD16a) and FcγRIIIb (CD16b), which participate in signal transduction. The most well-researched membrane receptor implicated in triggering lysis by NK cells, CD16 is a molecule of the immunoglobulin superfamily (IgSF) involved in antibody-dependent cellular cytotoxicity (ADCC). It can be used to isolate populations of specific immune cells through fluorescent-activated cell sorting (FACS) or magnetic-activated cell sorting, using antibodies directed towards CD16.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 49834488302

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
Y
Verified Purchase
Yuli
Battle Creek, US
★★★★★ 5
I love this milk frother, a must have for coffee lovers!
Color: Silver
I absolutely love this Bonsenkitchen milk frother! It creates the perfect foam in seconds and my coffee has never tasted so good. The rechargeable feature is so convenient and I love that it comes with a stand to keep it organized on my counter. It is easy to use, easy to clean and works perfectly every single time. If you love coffee at home this frother is a game changer, it makes you feel like you are at a coffee shop without spending a fortune. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
S
Verified Purchase
Sheila65
Alexandria, US
★★★★★ 5
Does the job!
Color: Silver
Great frother. Love that it's rechargeable. 3 speeds, double frothing ring. This one is way better than my last, battery operated one. A lot of people giving are negative reviews or deductin stars because they think you have to cycle through the speeds to turn it off - they're wrong. You just hold the button for a couple of seconds and it turns off. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026
J
Verified Purchase
Julia
Birmingham, US
★★★★★ 5
Great frother
Color: Silver
Excellent product. Works well and is easy to use. The charge lasts a long time. Worth the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 22, 2026
D
Verified Purchase
Dr Berry
Louisville, US
★★★★★ 4
Stand was my favorite part, hated how close off and higher speed is
Color: Silver
Well the first lesson is dont hit the power button to turn off, as it goes to 2nd speed and slings your drink everywhere. Im not happy with the stability of the brother, had better, as free with coffees. Positive is, it has a stand, it does have 3 speeds, just never needed the other two speeds, and if you dont hold power button long enough to turn off, it goes into higher speed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
W
Verified Purchase
William
Boise, US
★★★★★ 5
Bonsenkitchen Rechargeable Milk Frother witThe
Color: Silver
I drink a specialty coffee that uses a Keurig to dispense it when it comes out pot and it mixes well I use this to mix my collagen, my coffee and some mushrooms to help keep me active and it works perfectly. I’d recommend this to anybody that is mixing their coffee with others things.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026

recommand products