SKU: 53882774195

Mouse CD28, His tag

Sale price$144.00 Regular price$160.00
Save 10%

Pay in installments of $40.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD28, His tagProduct Specification Species Mouse Synonyms T cell specific surface glycoprotein CD28 Accession P31041 Amino Acid Sequence Protein sequence (P31041, Asn20 Leu150, with C 10*His) NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPKLGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 16. 9 kDa Observed MW: 35 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag

Product Specification


Species Mouse
Synonyms T-cell-specific surface glycoprotein CD28
Accession P31041
Amino Acid Sequence

Protein sequence (P31041, Asn20-Leu150, with C-10*His) NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPKLGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 16.9 kDa Observed MW: 35 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD28 (Cluster of Differentiation 28) is one of the proteins expressed on T cells that provide co-stimulatory signals required for T cell activation and survival. T cell stimulation through CD28 in addition to the T-cell receptor (TCR) can provide a potent signal for the production of various interleukins (IL-6 in particular). CD28 is the receptor for CD80 (B7.1) and CD86 (B7.2) proteins. CD28 is the only B7 receptor constitutively expressed on naive T cells. Association of the TCR of a naive T cell with MHC:antigen complex without CD28:B7 interaction results in a T cell that is anergic. CD28 was identified on bone marrow stromal cells, plasma cells, neutrophils and eosinophils. In addition, the level of positive CD28 decreases with age.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 53882774195

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
Y
Verified Purchase
Yuli
Houston, US
★★★★★ 5
I love this milk frother, a must have for coffee lovers!
Color: Silver
I absolutely love this Bonsenkitchen milk frother! It creates the perfect foam in seconds and my coffee has never tasted so good. The rechargeable feature is so convenient and I love that it comes with a stand to keep it organized on my counter. It is easy to use, easy to clean and works perfectly every single time. If you love coffee at home this frother is a game changer, it makes you feel like you are at a coffee shop without spending a fortune. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
S
Verified Purchase
Sheila65
Louisville, US
★★★★★ 5
Does the job!
Color: Silver
Great frother. Love that it's rechargeable. 3 speeds, double frothing ring. This one is way better than my last, battery operated one. A lot of people giving are negative reviews or deductin stars because they think you have to cycle through the speeds to turn it off - they're wrong. You just hold the button for a couple of seconds and it turns off. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026
J
Verified Purchase
Julia
Pawtucket, US
★★★★★ 5
Great frother
Color: Silver
Excellent product. Works well and is easy to use. The charge lasts a long time. Worth the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 22, 2026
D
Verified Purchase
Dr Berry
Massapequa, US
★★★★★ 4
Stand was my favorite part, hated how close off and higher speed is
Color: Silver
Well the first lesson is dont hit the power button to turn off, as it goes to 2nd speed and slings your drink everywhere. Im not happy with the stability of the brother, had better, as free with coffees. Positive is, it has a stand, it does have 3 speeds, just never needed the other two speeds, and if you dont hold power button long enough to turn off, it goes into higher speed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
W
Verified Purchase
William
Lexington, US
★★★★★ 5
Bonsenkitchen Rechargeable Milk Frother witThe
Color: Silver
I drink a specialty coffee that uses a Keurig to dispense it when it comes out pot and it mixes well I use this to mix my collagen, my coffee and some mushrooms to help keep me active and it works perfectly. I’d recommend this to anybody that is mixing their coffee with others things.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026

recommand products