SKU: 10720946152

Human CD45, His tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD45, His tagProduct Specification Species Human Synonyms Leukocyte common antigen (L CA), T200, CD45 Accession P08575 Amino Acid Sequence Protein sequence (P08575, Gln26 Gly100, with C 10*His) QSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPASTFERENDFSETTTSLSPDNTSTQVSPDSLDNASAFNTTGGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 9. 5 kDa Observed MW: 55 72 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical Appearance Lyophilized

Product Specification


Species Human
Synonyms Leukocyte common antigen (L-CA), T200, CD45
Accession P08575
Amino Acid Sequence

Protein sequence (P08575, Gln26-Gly100, with C-10*His) QSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPASTFERENDFSETTTSLSPDNTSTQVSPDSLDNASAFNTTGGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 9.5 kDa Observed MW: 55-72 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD45 is a member of the protein tyrosine phosphatase (PTP) family. CD45 contains an extracellular domain, a single transmembrane segment, and two tandem intracytoplasmic catalytic domains, and thus belongs to the receptor type PTP family. CD45 is a type I transmembrane protein that is present in various isoforms on all differentiated hematopoietic cells (except erythrocytes and plasma cells). CD45 has been shown to be an essential regulator of T- and B-cell antigen receptor signalling. It functions through either direct interaction with components of the antigen receptor complexes via its extracellular domain (a form of co-stimulation), or by activating various Src family kinases required for the antigen receptor signaling via its cytoplasmic domain. CD45 also suppresses JAK kinases, and so functions as a negative regulator of cytokine receptor signaling. CD45 does not colocalize with lipid rafts on murine and human non-transformed hematopoietic cells, but CD45 positioning within lipid rafts is modified during their oncogenic transformation to acute myeloid leukemia. CD45 colocalizes with lipid rafts on AML cells, which contributes to elevated GM-CSF signal intensity involved in proliferation of leukemic cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 10720946152

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tom
Whiting, US
★★★★★ 5
Great read for students
Format: Paperback
Studying cybersecurity, I thought "Black Hat Python, 2nd Edition" by Justin Seitz and Tim Arnold was quite helpful. This book makes difficult ideas far simpler by combining theory with practical examples. The revised material maintains it current given the cybersecurity issues of today. The practical uses it goes over, such as scraping and sniffing, which are essential skills for anyone working in the field. Whether you're brand-new or seasoned, the simple explanations make it easy to follow. Any student studying cybersecurity should not miss this book since it provides the ideal combination of knowledge and useful abilities through guided projects.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2024
R
Verified Purchase
Rayner
Charlottesville, US
★★★★★ 5
Python cybersecurity
Format: Paperback
Best book for entry level cybersecurity professional new to python.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 6, 2025
C
Verified Purchase
Cliente Amazon
Port Orchard, US
★★★★★ 4
The book is simply perfect. Very good book. Problem with shipping.
Format: Paperback
The book is simply perfect. Good book and good practical contents, complex, but direct at the same time with what it has to say. Very useful if you want to learn Python but from the point of view of a Hacker or Pentester. There was a problem with the shipping, it was solved, but I received the book days later and for a few hours the book was lost, and the shipping agency couldn't track it, and they didn't know where it was. Luckily in the end it was fixed and I received it a few days later.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 23, 2024
S
Verified Purchase
Seagull Stahpitnow
Los Angeles, US
★★★★★ 5
Tough read for a newbie
Format: Paperback
To start off, I am not the world’s best at writing code. I do have a low level understanding of the concepts and can figure out (with a longer amount of time) how to get some of the code functional. With this in mind, this book (if your a beginner or struggle with Python) is going to be a tough read and hard to practice. Its pseudocode is solid and makes the coding easier but you need to beware of pythons syntax differences between the different versions when you are using this. (This is something I struggle with). I am beyond happy with this book, albeit there are typos and errors inside it but I think it’s solid for practice in this field. Coming from a nontechnical profession, having the concepts explained and taken out from theory into working practice helps understand the practical side of doing something like this. Despite being a tough read, i have the frame of mind that ethical hacking and program development is not for a total newbie and some experience is needed for maximum efficiency. Hope this helps!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 23, 2024
N
Verified Purchase
NewBUTbarelyused
Birmingham, US
★★★★★ 5
💯 just buy
Format: Paperback
Hey guys I'm a im an E-black belt now
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026

recommand products