SKU: 62961358853

LILRA1 His Tag Protein, Human

Sale price$324.00 Regular price$360.00
Save 10%

Pay in installments of $90.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 23 - Aug 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRA1 His Tag Protein, HumanProduct Specification Species Human Accession O75019 1 Amino Acid Sequence Pro17 Asn461, with C terminal 8*His

Product Specification


Species Human
Accession O75019-1
Amino Acid Sequence Pro17-Asn461, with C-terminal 8*His PRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRLYREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTGAYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPGESLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGAYNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVSGAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVENGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 72-85 kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Leukocyte immunoglobulin-like receptors (LILRs) are inhibitory, stimulatory or soluble receptors encoded within the leukocyte receptor complex. LILRs includes activating (LILRA1, LILRA2, LILRA3) and inhibitory (LIRB1, LILRB2, LILRB3, LILRB4, LILRB5) isoforms. LILRA1, also known as CD85i and LIR-6, is a Protein Coding gene. Among its related pathways are Innate Immune System and Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell. Mature human LILRA1 consists of a 445 amino acid (aa) extracellular domain (ECD) with 4 Ig-like domains, a 21 aa transmembrane segment, and a 7 aa cytoplasmic tail. LILRA1 (LIR-6) can recognize MHC (major histocompatibility complex) class I or class I-like molecules, and high levels of sequence similarity among LILRA1, LILRA2 (ILT1), LILRA3 (ILT6) and LILRB1/B2. Among its related pathways are Innate Immune System and Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell. Gene Ontology (GO) annotations related to this gene include transmembrane signaling receptor activity and antigen binding.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 62961358853

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Johamis
Charlottesville, US
★★★★★ 5
Easy to use
Size: 58.3mm, Color: Black
Great for make good coffee and easy to use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 24, 2025
J
Verified Purchase
JK
Lexington, US
★★★★★ 5
Take the guess work out of the flow!
Size: 58.3mm, Color: Black
I got this because when my wife makes espresso, it's watery. When i make it, it's fine. We needed a controlled Tampering method so we both do the same job. This is heavy, and being able to use the whole hand instead of fingers, not much effort is needed. Since we purchased this, we were able to make consistent espresso shots for sure.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 12, 2024
R
Verified Purchase
Reviewer JR
New York, US
★★★★★ 3
Not as good as I expected
When it first came, the box fell apart as I was taking it out, and a lot of some kind of dirt or sand kept falling out all over my table and floor. I had the take the entire thing apart and thoroughly wash it. After drying age reassembling it, I tried it on my portafilter that came with my Breville Barista Express, but, somehow, it doesn't always make the tamping level. You would think with the ridge that rests on the side of the portafilter that it would force it to remain level, but, somehow, it doesn't, at least not consistently. It also has varying lengths (heights, or depths), and a single spring tension, so you may still over tamping or under-tamp. I was expecting it would have a censor that would just detect once it reached 30 lbs of force and cut off after that, similar to a torque screwdriver, but that's not what this is. I'll still give it 3 stars because, despite the problems mentioned above, it at least produces some amount of consistency, even if that isn't measurable; but, I can't give it 5 stars because of those issues mentioned above.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 7, 2025
B
Verified Purchase
Bernard Eisenfeld, M.D.
Fort Morgan, US
★★★★★ 5
This is the one.
Size: 58.3mm, Color: Black
As an el Supremo Coffee Geek, I've wasted money on lots of different tampers. Save your money and buy this one or it's equivalent. This thing is heavy duty, solid, well-made, self-leveling, tamps at 30 pounds and is fool-proof even for fools. Also, it's a palm tamper meaning more fun and more satisfying to use as you prep the puck for your morning buzz. Buy it. You will thank me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2024
L
lesserof2weevils
Battle Creek, US
★★★★★ 5
Super easy to use and takes the guess-work out of getting even pressure on the grounds
Size: 58.3mm, Color: Black, Size: 58.3mm, Color: Black
I have been using a hand tamper for many years and have a good idea of the pressure I am applying to the grounds in the portafilter. I honestly considered spring tampers to be a bit silly. But this tamper really does take the guess-work out of pressing the coffee grounds. The shroud helps guide the press so that pressure is applied even and flat across the surface. With the manual tamper, there will be some play when pressing, or some unevenness in pressure. This is especially true when cranking out many espressos during a breakfast party with friends. Having the spring tamper makes quick work of turning out a lot of coffees with consistency. There are no instructions for taking this tamper apart to clean inside, and you may not really need to do that very often. After each use, just pull back the shroud (the black piece that moves up and down) and wipe off the tamper (the shiny steel part). This will help prevent grounds from working their way inside. If you do want to take it apart, it’s easy. Pull back the shroud and unscrew the tamper. It will come apart into three pieces. Wipe the pieces off and reassemble. Super quick and easy. This tamper is very heavy. My scale shows 656 g (about a pound and a half). It fits the portafilter exactly, with no slop. Just place on top of grounds and press!. Don’t even worry about pressure, just push down all the way. Overall I had fun using this tamper versus my manual one. And since I make myself a cappuccino very early in the morning, I don’t have to be very awake to get a good pack on the grounds and get my coffee fast!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 10, 2024

recommand products