SKU: 65522343487

DDB1/CRBN Complex, Flag&His Tag, Human

Sale price$162.00 Regular price$180.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 10 - Jul 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

DDB1/CRBN Complex, Flag&His Tag, HumanProduct Specification Species Human Synonyms DDB1 CRBN Complex Accession Q16531Q96SW2 Amino Acid Sequence DDB1 Flag Tag, Human Met1 His1140

Product Specification


Species Human
Synonyms DDB1/CRBN Complex
Accession Q16531、Q96SW2
Amino Acid Sequence

DDB1 Flag Tag, Human
Met1-His1140
DYKDDDDKMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR
TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
CRBN His Tag, Human
Met1-Leu442
HHHHHHHHGGGSGGGSMAGEGDQQDAAHNMGNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQEREAQFGTTAEIYAYREEQDFGIEIVKVKAIGRQRFKVLELRTQSDGIQQA
KVQILPECVLPSTMSAVQLESLNKCQIFPSKPVSREDQCSYKWWQKYQKRKFHCANLTSWPRWLYSLYDAETLMDRIKKQLREWDENLKDDSLPSNPIDFSYRVAACLPIDDVLRIQLLKIGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTIPDTEDEISPDKVILCL

Expression System Baculovirus-InsectCells
Molecular Weight

128&53kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tags & Cleavage sites Flag Tag; His Tag
Physical Appearance Liquid
Storage Buffer 20mM Tris,300mM NaCl,10%Glycerol,1mM DTT, pH7.5.
Stability & Storage

·12 months from date of receipt, -20 to -70 °C as supplied.
·1 month, 2 to 8 °C under sterile conditions after reconstitution.
·Please avoid repeated freeze-thaw cycles.

Reference

Fischer E.S.,et al. (2014) Nature 512: 49
He Y.J., et al. (2006) Genes Dev. 20: 2949
Ito T., et al. (2010) Science 327: 1345
Wang H., et al. (2006) Mol. Cell 22: 383

Background

Cereblon (CRBN) is the substrate recognition component of DCX (DDB1-CUL4-X-box) E3 Ubiquitin ligase complexes that mediate the ubiquitination of numerous target proteins including the transcriptional regulator MEIS2. CRBN plays an important role in limb outgrowth, and its function in this process is perturbed by the binding of thalidomide and related compounds. Binding of CRBN to Cullin-4 is mediated in part by DNA damage-binding protein 1 (DDB1), a component of multiple DCX class ligases. In addition to its role in limb development, DDB1 is also involved in various DNA damage response mechanisms. This product consists of an untagged complex of DDB1 and CRBN.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65522343487

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 1099 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Matt M
Waukegan, US
★★★★★ 5
Thorough, clear, enlightening, and inspiring - not often achieved in academia
Format: Paperback
This is an extraordinarily well-researched manual. It presents for the reader a Catholic-Christian perspective on psychology/mental health which is faithful to the magisterial teachings of the Church and the Christian tradition. So much good will come to the clinician/professor/pastoral leader/student/generally-concerned-citizen who engages thoughtfully with the CCMMP. More to the point, those whom they serve will reap the real harvest. This could be one of the most important books written in this century. Yes. Bold claim. Bolder still and brighter yet the vision of the human person elucidated in this volume. "The glory of God is a human person fully alive" (St. Irenaeus of Lyon) The CCMMP sheds light for the reader to catch that vision of God's image (the human person) in a world so dimmed by confusion. Read this book. Or pick put some chapters that are of particular interest to you and go through those. You'll be glad you did.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2020
S
Verified Purchase
Samuel Bendeck Sotillos
Chelsea, US
★★★★★ 5
Towards a Christian Psychology or Cure of Souls
Format: Paperback
Mental health professionals will benefit from this comprehensive manual that has been extensively researched, as it provides a way forward in the direct application of the Christian tradition in a therapeutic context. This book restores the authority within psychology back to the spiritual dimension rather than the empiricism and rationalism that is the legacy of the Enlightenment project and consequently of mainstream psychology. An important matter not addressed in this study are the arguably deleterious impacts of the Second Vatican Council (1962–1965) on the hearts and minds of the faithful, not to mention the crisis in religious vocations to which it has led. Therefore, references to the doctrinal teachings of Vatican II (and the contemporary church) should be considered with discernment so that a clear distinction can be maintained between traditional Catholicism and some of its modern aberrations (Coomaraswamy, 2006). Notwithstanding, the book has many strengths that will benefit therapists who are interested in Christian psychology, or the “science of the soul” found within all of the world’s religions. It is by adhering to one of the divinely revealed spiritual traditions that we can gain access to a liberating discernment—“Ye shall know the truth and the truth shall make you free” (John 8:32)—which is essential for any integral therapy and healing. -Spiritual Psychology and Counseling, Vol. 7, No. 2 (2022)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 4, 2022
H
Verified Purchase
HC
West Palm Beach, US
★★★★★ 5
tour de force work, written in the Catholic intellectual tradition
Format: Hardcover
What a masterpiece. I would recommend this book as required reading for Catholics in the helping professions--counseling, social work, clinical psychology, etc. I'm a grad student in Catholic counseling at a non-Catholic institution, and this has been a go-to text in my classes. So grateful to the professors and contributors at Divine Mercy University for their many, many years and sacrifices putting this treatise together. It is going to bear much fruit in the years to come. Thank you!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 2, 2021
J
Verified Purchase
Jim
Alexandria, US
★★★★★ 5
This is an excellent piece of work
Format: Kindle
For anyone who is interested in learning more about the integrated human person, this book does a very nice job of exploring the theological, phycological, and emotional attributes of the human person. It is a bit on the academic side and not light bedtime reading ;-). But, it is well worth the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 31, 2020
C
Charles Schmidt
Los Angeles, US
★★★★★ 5
A good psychology helps you to be good
Format: Paperback
Modern psychology is still in its infancy, being more art than science. A Catholic Christian Meta-Model of the Person by Paul C Vitz and other authors is a breakthrough achievement in advancing psychology in both theory in practice in that it uses Catholic theology and philosophy to ennoble psychology. This book contains many insights into human nature, such as: Worldviews and values systems, be they implicit or explicit, influence every theoretical reflection and interpersonal interaction. The Catholic worldview and value system is wider than any of the many partial theories currently existing the psychological and mental health field. Most secular psychologies are based on materialist, reductionist worldview that considers man as just a material animal. The Catholic view of man is that he is a unity of spiritual soul and material body, so it is a more comprehensive and accurate conception of human nature. Note that even so-called facts are always understood in terms of our worldview [Worldviews and value systems have a strong influence on your thoughts and on your actions. Since the Catholic worldview is more comprehensive and deeper than the worldviews used in most schools of psychology, a Catholic psychology is superior to secular psychologies.] Pope Benedict XVI wrote that people recognize the good only when they themselves do it. They recognize evil only when they do not do it [People generally do not knowing do evil; rather, they rationalize that the evil they are doing is actually good. Doing evil reduces one’s ability to recognize evil.] What causes human suffering? Suffering is rooted in human experiences of physical pain, moral evil, psychological disorder, relational losses and conflicts, and spiritual trials. It is also rooted in the lack of hope, joy, or flourishing. Much personal suffering is caused by a lack of purpose and fulfillment. Such suffering can be insignificant or unceasing. It can be trivial or salvific. No matter how suffering is understood, hope or despair makes the difference in what is bearable. [Catholic psychology offers hope, which makes suffering bearable.] The Catholic model of the person presupposes that flourishing, beatitude and joy constitute the deepest reality and provident goal of human life. This goal can be experienced in part at present and in full at the end of time. Hope, both natural and ultimate (theological) hope, is foundational. Even in the midst of inevitable spiritual suffering, psychological distress and physical death, this teleological perspective on suffering helps to explain why experiences of languishing are repugnant to our deepest desire for flourishing: instead of longing for material goods, the Catholic model offers longings for true goods, such as existence and life; harmonious marriage, family, and social relations; truth and beauty; and ultimately, communion with God. [The Catholic model offers patients goods such as truth, beauty and God, which secular psychology ignores.] The simple lack of many of these goods (or a distorted search for them) is often the cause of suffering, despair, loneliness and anxiety. When humans pursue goods in a disordered way, even attempts to remedy human pain, suffering and languishing can become ineffective. For instance, self-preservation, pleasure, and marital relations are real goods to be desired, sought and enjoyed. These goods, however, are not ultimate goods. A disordered approach for these goods (trying to make ultimate what is not) causes further types of suffering [Seeking worldly goods causes further suffering. Only ultimate goods offer a joy that cures suffering.] Men are called to goodness. Through a calling or vocation, each person is attracted to and perfected through existence (being), truth (knowledge), goodness (love), relationship (family, friends, and society, and beauty (integrity, ordering and clarity). [Human happiness comes from human flourishing - human perfection - and flourishing comes from living, health, knowledge, goodness, friends and beauty. To truly flourish, humans need beauty, which means art and music.] There is now an enormous amount of psychological evidence for the importance of relationships in the formation of the person. Relationships are essential for basic human existence and development. A newborn child who lacks a mothering relationship with another human will die, even if its physical needs are met. A person learns to speak through loving relationships that begin in the first weeks after birth, when the infant first listens to its mother’s voice. Language-learning requires relationships, and is foundational to the human person. [Man is the rational, social animal. Man’s essence and purpose is to have good relationships with other human beings. This is why people are more important than things. Man is not just the rational animal, man is the rational, spiritual, passionate, philosophical, purposeful, social, moral, free, aesthetic, creative, loving, sacred, religious and fallen (prone to sin and evil) animal who seeks happiness.] The above excepts are just a few of the many profound insights that can be found in this masterpiece of modern psychology. This proposed Catholic psychology helps heal the soul, which secular psychology ignores, and which is why this book is so necessary.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 24, 2021

recommand products