Pay in installments of $90.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 23 - Aug 28
For Your Every Summer RSVP, with Code: SUMMER15
Description
LILRA1 His Tag Protein, HumanProduct Specification Species Human Accession O75019 1 Amino Acid Sequence Pro17 Asn461, with C terminal 8*His
Product Specification
| Species | Human |
| Accession | O75019-1 |
| Amino Acid Sequence | Pro17-Asn461, with C-terminal 8*His PRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRLYREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTGAYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPGESLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGAYNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVSGAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVENGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 72-85 kDa (Reducing) |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
Leukocyte immunoglobulin-like receptors (LILRs) are inhibitory, stimulatory or soluble receptors encoded within the leukocyte receptor complex. LILRs includes activating (LILRA1, LILRA2, LILRA3) and inhibitory (LIRB1, LILRB2, LILRB3, LILRB4, LILRB5) isoforms. LILRA1, also known as CD85i and LIR-6, is a Protein Coding gene. Among its related pathways are Innate Immune System and Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell. Mature human LILRA1 consists of a 445 amino acid (aa) extracellular domain (ECD) with 4 Ig-like domains, a 21 aa transmembrane segment, and a 7 aa cytoplasmic tail. LILRA1 (LIR-6) can recognize MHC (major histocompatibility complex) class I or class I-like molecules, and high levels of sequence similarity among LILRA1, LILRA2 (ILT1), LILRA3 (ILT6) and LILRB1/B2. Among its related pathways are Innate Immune System and Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell. Gene Ontology (GO) annotations related to this gene include transmembrane signaling receptor activity and antigen binding.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.7 ★★★★★
Based on 13 reviews
Sort
Product Reviews
★★★★★ 5
Stop wasting your money on green slime or Fix-A-Flat or any of the other tire sealant
Size: 1-Gallon (128 oz)
Flat out is by far the best product on the market to fix flat tires and prevent flat tires. This will be the second gallon jug that I purchased that stuff on everything. all of my landscape equipment has it in every tire. And to paint and even better picture for you I have a scag mower that is 20 years old The tires are probably 18 years old ugly as could be and would not hold air until I put the flat out in it it has been sitting now for over a year and every tire still has air That's how good the stuff is. Don't just buy one gallon by two cuz it will get used
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 11, 2025
★★★★★ 5
John Deere 5x4 (gator)
Size: 4-Pack (128 oz), Size: 4-Pack (128 oz)
Excellent product. The John Deere 5x4 (Gator) in picture sat for ten years, the tires were flat, the front tire was the worse. To move this Gator from my neighbors place he had to load it on a trailer, he aired up the rear 4 tires but the front would air up and leak before he could move it. He put a make do wheel to get it moved to my place. shortly after unloading the rear 4 tires went flat. All were badly weathered. I read about a stop leak "FLATOUT" I ordered one bottle and put it in the front wheel and I aired it up, it held air for several hours. I called FLATOUT Support and told them I put 1/2 bottle in front tire and how it helped, He said it calls for a full bottle per tire so I added the rest of the FLATOUT. I bought four more bottles of FLATOUT and put those in all 4 tires, put air in and drove the unit a block. next day two tires were low so I finished putting FLATOUT in and aired the tires and drove two to three blocks. the weather snowed so I parked the Gator for two weeks, the tires never went flat. I checked the air pressure and had lost about 2-3 pounds, refilled with air and on a warm day drove the Gator about 2 miles. No flat tires. Note the front tire had a weathered crack 4 inches long where it sat folded for so many years and I saw where this product had sealed this leak and no air loss after two weeks of sitting.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2021
★★★★★ 5
Recommended
Works extremely well for tire patch repairs. Just be sure product is totally dry before applying patch on inner tube or interior of tubeless tire.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 25, 2026
★★★★★ 5
CVC works well
CVC works well for tire plugging and patching
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 27, 2025
★★★★★ 5
Muy bueno
Excelente producto, pensé a no me alcanzaba porque es pequeña la lata y como rinde , es espeso cantidad y fácil de trabajar , una maravilla
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 18, 2025